PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038276.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 346aa    MW: 38163.1 Da    PI: 7.4961
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038276.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-55161441129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ + 
  Pbr038276.1  16 LPPGFRFHPTDEELITYYLLKKVLDSSFTG-RAIAEVDLNKCEPWELPDKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSkTC 112
                  79*************************999.89***************99999****************************************97455 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  +lvg+kktLvfy+grapkgek++Wvmheyrle
  Pbr038276.1 113 ALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 144
                  67****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6312168IPR003441NAC domain
PROSITE profilePS5100560.10716168IPR003441NAC domain
PfamPF023658.0E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MDIMSFSTQF DHNTHLPPGF RFHPTDEELI TYYLLKKVLD SSFTGRAIAE VDLNKCEPWE  60
LPDKAKMGEK EWYFFSLRDR KYPTGLRTNR ATEAGYWKAT GKDREIYSSK TCALVGMKKT  120
LVFYRGRAPK GEKSNWVMHE YRLEGKFAYH YLSRSSKDEW VISRVFQKSS GSAATGPGSK  180
KIRMGNGSTS SVSLCPEPSS PSSVSLPPLL DSSPYQPVSA AGDGCSYDSP IPMEHVSCFS  240
TNPSNNGFNL PASCFDLAHP PPPQPPNFGG VSAFPSLRSL QENLQLPLFF SPMPAHPPVH  300
VGSSVAGGGS SVDFTGNWPP VSEEVRAVGP TELDCMWNYF KTECL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-521617217169NO APICAL MERISTEM PROTEIN
1ut4_B9e-521617217169NO APICAL MERISTEM PROTEIN
1ut7_A9e-521617217169NO APICAL MERISTEM PROTEIN
1ut7_B9e-521617217169NO APICAL MERISTEM PROTEIN
3swm_A1e-511617220172NAC domain-containing protein 19
3swm_B1e-511617220172NAC domain-containing protein 19
3swm_C1e-511617220172NAC domain-containing protein 19
3swm_D1e-511617220172NAC domain-containing protein 19
3swp_A1e-511617220172NAC domain-containing protein 19
3swp_B1e-511617220172NAC domain-containing protein 19
3swp_C1e-511617220172NAC domain-containing protein 19
3swp_D1e-511617220172NAC domain-containing protein 19
4dul_A9e-521617217169NAC domain-containing protein 19
4dul_B9e-521617217169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340641.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-116NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM5X6640.0M5X664_PRUPE; Uncharacterized protein
STRINGGLYMA12G26190.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-107NAC family protein